PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN32214.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 574aa    MW: 63492.1 Da    PI: 5.8231
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN32214.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.91.7e-084915291854
                 HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  KHN32214.1 491 MFQNflHPYPKDAEKHLLAVKSGLTRSQVSNWFINARVR 529
                 5887779******************************88 PP

2BELL74.22.1e-24363432171
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                 +r++ ++kk++Ll+ll+ Vd+rY+q+ ++++tv+s+F+a+++l++ ++++++Al++iS  +r L+++i++ 
  KHN32214.1 363 QRHAAESKKSQLLTLLQLVDNRYSQCLDEIHTVVSAFQAATELDP-QIHAHFALQTISILYRDLRERISNY 432
                 68999****************************************.**********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.6E-21287431IPR006563POX domain
PfamPF075261.7E-26293430IPR006563POX domain
PROSITE profilePS5007111.078470533IPR001356Homeobox domain
CDDcd000863.55E-11473534No hitNo description
SMARTSM003896.9E-6473537IPR001356Homeobox domain
SuperFamilySSF466892.44E-15475542IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.7E-26476539IPR009057Homeodomain-like
PfamPF059209.2E-15490529IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MESDMYTAAL DISGREATVI DEISQHSASN PLIQCYSLDL NNQSHIISGI SMLSGEQGEP  60
INNVHADACF INPSIIADSS PLVISQGKTI VAVGDASNPM ENTELQEHLA GGMPITPSSL  120
AAILAARTGL EENLGNSSSA LPPSLCSMGA LGAFFNNLQG TSNSNPLSAT FEDCGYNEVS  180
SKWNANKFPK APEIDGTCQP YPFIANLDQN EWPSSNVANM ANHAYHSSHF SKELSLSLAT  240
STTAGMCSEV SCSNVTPCMN GTMSGLEQAS CSSSRELSMN LGGNKYVEFS PEVLESRYLV  300
GIQEILAQIG RYSFENLEQL NYSAGNHRSG GNKSSSAFPP KRRILIDHNA NSTYEAHAES  360
PLQRHAAESK KSQLLTLLQL VDNRYSQCLD EIHTVVSAFQ AATELDPQIH AHFALQTISI  420
LYRDLRERIS NYILAMGSNF NNSCSEENEW SVETSFLQKQ WALQQLKRKD QLWRPQRGLP  480
ERSVSVLRAW MFQNFLHPYP KDAEKHLLAV KSGLTRSQVS NWFINARVRL WKPMIEEMYA  540
EMNKRKACRN EEGMQSNHGT RISTTNERFN QCQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B8e-15479536158Homeobox protein Meis1
4xrs_A8e-15479536158Homeobox protein Meis1
3k2a_B9e-15479537563Homeobox protein Meis2
3k2a_A9e-15479537563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0945590.0BT094559.1 Soybean clone JCVI-FLGm-18H4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006581286.10.0PREDICTED: homeobox protein ATH1-like isoform X1
RefseqXP_006581287.10.0PREDICTED: homeobox protein ATH1-like isoform X1
RefseqXP_006581288.10.0PREDICTED: homeobox protein ATH1-like isoform X1
SwissprotP487311e-103ATH1_ARATH; Homeobox protein ATH1
TrEMBLA0A0B2RIS60.0A0A0B2RIS6_GLYSO; Homeobox protein ATH1
STRINGGLYMA06G05430.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59393249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.12e-95homeobox gene 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]